Protein Synthesis and HomeostasisOur second project had two parts one about protein synthesis, which is when a boilogical cells generate new proteins, and homeostasis. My group and I had to select one protein and research how it synthesized. We choose the SBHG, the sex binding hormone gloubin. Our research consisted of finding out how its made, what's the prtein's purpose, where it's found, and what would happen if humans didn't have this protein. The last thing we had to find was the DNA sequence of our protein which was PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHN.
The homeostasis project was way more interesting. We got to choose these groups. We started by researching homeostasis, what is was, why we need it and examples. The next part of this was to pick one thing that homeostasis regulated, like body temperature, blood pressure, and heart rate, and design an experimant around that. We choose heart rate, and how the heart rate increases or decreases to maintain homeostasis, due to the body's physical excursion. To do this we asked multiple test subjects, all in healthy condition, and made them take their heartbeat with their index finger and run 1/4 of a mile. They then redid their heart rate after running, and again every minute until it returned to normal. Showing the heart rate homeostasis. Finally my group and I made a report on google docs and made a presentation on google slides. |
Our Data (Protein Synthesis)Our Presentation (Protein synthesis)
|
Our Data (Homeostasis)
Our Presentation (Homeostasis)
Reflection
The first part of the project was very informational. I learned about proteins and how they are formed. The education aspect was very nice but the project in total was laching in creativity and was tedious.
I think one thing I have to improve on is leadership. I am very shy sometimes, and I don't want the attention placed on me when I speak. To try and improve this, I should speak out when I have a good idea instead of keeping it to myself.
The second part of the project was very fun because we had rhe chance to create our own experiment with a group we choose. I think I improved with my leadershio skills during this project because I got to work with friends.
I think one thing I have to improve on is leadership. I am very shy sometimes, and I don't want the attention placed on me when I speak. To try and improve this, I should speak out when I have a good idea instead of keeping it to myself.
The second part of the project was very fun because we had rhe chance to create our own experiment with a group we choose. I think I improved with my leadershio skills during this project because I got to work with friends.